PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462881447
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 296aa    MW: 33223.2 Da    PI: 9.9671
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462881447genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.41e-153074147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E+ellv+a   +G + WktI + +g ++t+ q++s+ qky
        462881447 30 REKWTADEHELLVHALLVFGRD-WKTIEQFVG-TKTATQIRSHAQKY 74
                     789*****************77.*********.*************9 PP

2Myb_DNA-binding47.93.1e-15140184147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E+e++v+a   +G + WktI + +g ++t+ q++s+ qky
        462881447 140 REKWTADEQERFVHALLVFGRD-WKTIEQFVG-TKTATQIRSHAQKY 184
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-152479IPR009057Homeodomain-like
PROSITE profilePS5129417.9862579IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-82782IPR009057Homeodomain-like
SMARTSM007172.4E-102977IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.1E-132977IPR006447Myb domain, plants
PfamPF002497.3E-133074IPR001005SANT/Myb domain
CDDcd001671.11E-83275No hitNo description
SuperFamilySSF466894.64E-15135189IPR009057Homeodomain-like
PROSITE profilePS5129417.102135189IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-7138180IPR009057Homeodomain-like
SMARTSM007179.8E-10139187IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.3E-15139187IPR006447Myb domain, plants
PfamPF002492.7E-12140184IPR001005SANT/Myb domain
CDDcd001673.68E-8142185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MVMMAARNTT GAPALGTKKP RKPYTISRPR EKWTADEHEL LVHALLVFGR DWKTIEQFVG  60
TKTATQIRSH AQKYFLKAHK HGLAAALPPP HPRRALLHQE EDTVQQLPLS PDDLRFAEVY  120
RFVGDVFGSG APRPTISRPR EKWTADEQER FVHALLVFGR DWKTIEQFVG TKTATQIRSH  180
AQKYFLKAHK HGLAAALPPP HPRRALLHQE EDTVQQLPLS PDDLRFAEVY RFVGDVFGSG  240
APRPVEVQLQ RLHGMDPVVA ETILLMICVS LRGAGSDVCS GASLPVEAQL QRLPTE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGRMZM2G115070_P011e-52(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09600.24e-21MYB_related family protein